PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009775304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 281aa    MW: 30064.1 Da    PI: 10.1538
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009775304.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.94e-373591561
          zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                     +kcprCds+ntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGggrrk k +
  XP_009775304.1 35 PQKCPRCDSNNTKFCYYNNYSLTQPRYFCKTCRRYWTQGGTLRNVPVGGGRRKGKCT 91
                    689**************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-20581IPR003851Zinc finger, Dof-type
PfamPF027011.1E-313689IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.233690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEQGRSGGES DRNQQRKMKM PENLSAVAPP PQPPPQKCPR CDSNNTKFCY YNNYSLTQPR  60
YFCKTCRRYW TQGGTLRNVP VGGGRRKGKC TTRGGGGSSS SSAGESSSRS SQGAQLPPVV  120
ALNMTTNLSA AAAFFSGNSI SRSQPLNSLY SSGGFLPSLA AMQSQGVNQP SNSPFGGTSN  180
TVLLQGFHNL PKEPQQSGFY QMVNKEKSNE SSFYLSDQTL QFQPTRPMGS WTQRFINNNM  240
DSWNSSAGSS SGSGGATNST TAGSSLSPNQ WPDMPGFGPS P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754419e-74HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009775304.10.0PREDICTED: dof zinc finger protein DOF5.8-like
RefseqXP_016492349.10.0PREDICTED: dof zinc finger protein DOF5.8-like
TrEMBLK4B9212e-73K4B921_SOLLC; Uncharacterized protein
STRINGSolyc02g077960.1.16e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-26TARGET OF MONOPTEROS 6